Cure Cancer with AI

Developer API

A free, public REST API over our continuously-updated oncology dataset — research papers, news, blog posts, FDA approvals, and clinical trials — plus IBM MAMMAL biomedical model predictions (protein–protein, drug–target, and ClinTox toxicity).

Data endpoints are read-only GET requests; the MAMMAL prediction endpoints are POST requests that take a JSON body. All return JSON. The API is free to use — you just need a free API key, which you can generate from your account.

Get your free API key → (sign in required). Base URL: https://www.curecancerwithai.com

View document

Building with an AI agent? Copy the full, machine-readable API instructions and paste them into your agent.

Machine-readable specs: OpenAPI 3.1 · Agent instructions · llms.txt

Authentication

Pass your key in the Authorization header as a Bearer token (an x-api-key header is also accepted). Requests without a valid key receive 401 Unauthorized.

curl "https://www.curecancerwithai.com/api/v1/research?limit=1" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

Rate limits

The free tier allows 100 requests per hour, per key (rolling window). Every response includes these headers:

  • X-RateLimit-Limit — your hourly limit (100).
  • X-RateLimit-Remaining — requests left in the current window.
  • X-RateLimit-Reset — ISO timestamp when the window resets.

Exceeding the limit returns 429 Too Many Requests with a Retry-After header.

Response shape

List endpoints return a data array plus pagination metadata:

{
  "data": [ { /* record */ }, ... ],
  "pagination": {
    "total": 1280,
    "limit": 20,
    "offset": 0,
    "page": 1,
    "totalPages": 64
  }
}

Errors use a consistent shape:

{ "error": "Invalid or revoked API key." }

MCP server (for AI agents)

Connect an AI agent (Claude, ChatGPT, and other MCP clients) to call this API directly as tools.

We expose a remote Model Context Protocol server over Streamable HTTP at https://www.curecancerwithai.com/api/mcp. It wraps every endpoint below as a tool — searching research, news, blog posts, FDA approvals, and clinical trials, plus the three MAMMAL predictions. Authenticate with the same free API key, sent as an Authorization header.

Client configuration

{
  "mcpServers": {
    "cure-cancer-with-ai": {
      "url": "https://www.curecancerwithai.com/api/mcp",
      "headers": { "Authorization": "Bearer ccw_live_YOUR_KEY" }
    }
  }
}

Tools: search_oncology, list_research, get_clinical_trial, predict_ppi, and more — one per endpoint, plus mammal_health.

Endpoints

GET/api/v1/researchData:PubMed (NCBI)

Research papers

Peer-reviewed oncology research papers ingested from PubMed, including abstracts, authors, journal, and plain-language summaries.

Query parameters

  • cancerType — Filter by cancer type, e.g. "lung".
  • treatmentType — Filter by treatment type.
  • search — Keyword search across title and abstract.
  • from / to — Filter by publication date (ISO, e.g. 2024-01-01).
  • limit — Results per page (1–100, default 20).
  • offset — Number of results to skip (default 0).

Example

curl "https://www.curecancerwithai.com/api/v1/research?cancerType=lung&limit=10" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/research/{idOrPubmedId}Data:PubMed (NCBI)

Single research paper

Fetch one paper by its internal id or PubMed id.

Example

curl "https://www.curecancerwithai.com/api/v1/research/38123456" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/newsData:Cancer news publisher RSS feeds

News

Curated cancer news articles aggregated from trusted sources.

Query parameters

  • cancerType — Filter by cancer type.
  • search — Keyword search across title, summary, and content.
  • from / to — Filter by published date.
  • limit — Results per page (1–100, default 20).
  • offset — Number of results to skip (default 0).

Example

curl "https://www.curecancerwithai.com/api/v1/news?cancerType=breast&limit=5" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/blogData:CureCancerWithAI.com

Blog posts

Editorial blog articles. Returns excerpts; fetch a single post by slug for full content.

Query parameters

  • category — Filter by primary category.
  • cancerType — Filter by cancer-type tag.
  • search — Keyword search across title, excerpt, and content.
  • limit — Results per page (1–100, default 20).
  • offset — Number of results to skip (default 0).

Example

curl "https://www.curecancerwithai.com/api/v1/blog?limit=10" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/blog/{slug}Data:CureCancerWithAI.com

Single blog post

Fetch one blog post by slug, including the full article content.

Example

curl "https://www.curecancerwithai.com/api/v1/blog/immunotherapy-breakthroughs" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/fda-approvalsData:openFDA (U.S. FDA)

FDA approvals

FDA-approved oncology drugs with indication, company, approval date, and label links.

Query parameters

  • cancerType — Filter by associated cancer type.
  • search — Keyword search across drug name, generic name, and indication.
  • from / to — Filter by approval date.
  • limit — Results per page (1–100, default 20).
  • offset — Number of results to skip (default 0).

Example

curl "https://www.curecancerwithai.com/api/v1/fda-approvals?limit=5" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/clinical-trialsData:ClinicalTrials.gov

Clinical trials

Clinical trials ingested from registries, including conditions, status, and intervention type.

Query parameters

  • condition — Filter by condition.
  • status — Filter by trial status, e.g. "RECRUITING".
  • search — Keyword search across title and description.
  • limit — Results per page (1–100, default 20).
  • offset — Number of results to skip (default 0).

Example

curl "https://www.curecancerwithai.com/api/v1/clinical-trials?status=RECRUITING&limit=10" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/clinical-trials/{nctId}Data:ClinicalTrials.gov

Single clinical trial

Fetch one trial by NCT id, including eligibility criteria and locations.

Example

curl "https://www.curecancerwithai.com/api/v1/clinical-trials/NCT01234567" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

GET/api/v1/searchData:CureCancerWithAI.com (aggregated datasets)

MASS search

Search a keyword across every dataset at once — research, news, blog, FDA approvals, and clinical trials — with results grouped by type.

Query parameters

  • q — Required. The keyword to search for.
  • types — Optional comma-list to narrow datasets: research,news,blog,fdaApprovals,clinicalTrials.
  • cancerType — Optional cancer-type filter applied to every dataset.
  • limit — Max results per dataset (1–100, default 5).

Example

curl "https://www.curecancerwithai.com/api/v1/search?q=osimertinib&types=research,fdaApprovals" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

POST/api/v1/mammal/ppiData:IBM MAMMAL

MAMMAL — protein–protein interaction

Predict the binding-affinity class for a pair of proteins using the IBM MAMMAL biomedical foundation model. label is "1" (interacting) or "0" (non-interacting).

Body parameters (JSON)

  • protein_a — Required. Amino-acid sequence, single-letter codes.
  • protein_b — Required. Amino-acid sequence, single-letter codes.

Example

curl -X POST "https://www.curecancerwithai.com/api/v1/mammal/ppi" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY" \
  -H "Content-Type: application/json" \
  -d '{"protein_a":"MADQLTEEQIAEF...","protein_b":"MSSKLLLAGLDIE..."}'

Example response

{ "data": { "prediction": "<SENTINEL_ID_0><1><EOS>", "label": "1" } }

POST/api/v1/mammal/dtiData:IBM MAMMAL

MAMMAL — drug–target interaction (pKd)

Predict drug–target binding affinity as pKd (−log₁₀ Kd). Higher pKd means stronger predicted binding.

Body parameters (JSON)

  • target_seq — Required. Target protein amino-acid sequence (single-letter codes).
  • drug_seq — Required. Drug structure in SMILES notation.
  • norm_y_mean — Optional number. Normalization mean override.
  • norm_y_std — Optional number. Normalization standard-deviation override.

Example

curl -X POST "https://www.curecancerwithai.com/api/v1/mammal/dti" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY" \
  -H "Content-Type: application/json" \
  -d '{"target_seq":"NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC","drug_seq":"CC(=O)NCCC1=CNc2c1cc(OC)cc2"}'

Example response

{ "data": { "pKd": 5.4932751 } }

POST/api/v1/mammal/clintoxData:IBM MAMMAL

MAMMAL — ClinTox clinical-trial toxicity

Predict clinical-trial toxicity for a compound. pred is 1 (toxic / likely to fail trials) or 0 (not toxic); score is the raw positive-class score.

Body parameters (JSON)

  • smiles — Required. Compound structure in SMILES notation.

Example

curl -X POST "https://www.curecancerwithai.com/api/v1/mammal/clintox" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY" \
  -H "Content-Type: application/json" \
  -d '{"smiles":"CC(CCl)OC(C)CCl"}'

Example response

{ "data": { "pred": 0, "score": 0.000019 } }

POST/api/v1/pharma/searchData:Moore Metrics

Pharma — compound search

Find pharmaceutical compounds by setting target characteristics (−4…+4 scale) or by entering example drugs you already know. Provide exactly one of examples or preferences.

Body parameters (JSON)

  • examples — Array of 1–50 known drug names (fuzzy-matched). Mutually exclusive with preferences.
  • preferences — Object of characteristic → value on the −4…+4 scale, e.g. {"Neuroactive":3}. Omit a characteristic to ignore it.
  • limit — Optional. Max results (1–100, default 20).
  • include_characteristics — Optional boolean. Include each result’s characteristic scores.

Example

curl -X POST "https://www.curecancerwithai.com/api/v1/pharma/search" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY" \
  -H "Content-Type: application/json" \
  -d '{"preferences":{"Neuroactive":3,"Immunoactive":-2},"limit":5}'

Example response

{ "data": { ...ranked compounds } }

GET/api/v1/pharma/characteristicsData:Moore Metrics

Pharma — characteristics

List the compound characteristics (each scored on the −4…+4 scale) usable as preferences keys in the compound search endpoint.

Example

curl "https://www.curecancerwithai.com/api/v1/pharma/characteristics" \
  -H "Authorization: Bearer ccw_live_YOUR_KEY"

Ready to build?

Get your free API key